|
Home > Offers to Sell > Chemicals & Plastics > Other Chemicals > Other Chemicals
SPECIFICATION OF IBERIOTOXIN
CAT K1060-V CAS NO. 129203-60-7 Product Name Iberiotoxin Purity > 98% Form/State Lyophilized powder Solubility Soluble in water Molecular weight 4230.9 Da Molecular formula C179H276N50O56S7 Source Synthetic peptide Storage Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20C. Storage of solutions Up to two weeks at 4C or three months at -20C. Sequence ZFTDVDCSVSKECWSVCKDLFGVDRGKCMGKKCRCYQ(Disulfide bonds between Cys7-Cys28, Cys13-Cys33, and Cys17-Cys35. Z = Pyrrolidone carboxylic acid)
APPLICATION OF IBERIOTOXIN Iberiotoxin (IbTX) is a remarkably selective alpha-K toxin peptide (alpha-KTx) inhibitor of the maxi-K channel.
As one of peptide manufacturing companies, we will produce more high quality products for customers, if you have needs, please contact us.
If you want to know more about synthetic route, please visit our website.
Click to Enlarge
SOURCE: Import-Export Bulletin Board (https://www.imexbb.com/)
Post an Offer to Sell
© 1996-2010 IMEXBB.com. All rights reserved.
|
|