|
Home > Offers to Sell > Chemicals & Plastics > Other Chemicals > Other Chemicals
MAMBALGIN 1
ASIC1 channels, Mambalgin 1 is a blocker of ASIC1 channels1,2
SPECIFICATION OF MAMBALGIN 1 CAT O1010-V CAS NO. 1609937-15-6 Product Name Mambalgin Purity > 98% Form/State Lyophilized powder Solubility Soluble in water Molecular weight 6554.5 Da Molecular formula C272H429N85O84S10 Source Synthetic peptide Storage Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20C. Storage of solutions Up to two weeks at 4C or three months at -20C. Sequence LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETEN , NKCCSTDRCNK(Disulfide bonds between Cys4-Cys37, Cys6-Cys30, and Cys20-Cys38)
APPLICATION OF MAMBALGIN 1 Mambalgin-1 is a peptide that acts as a potent analgesic through inhibiting acid-sensing ion channels (ASIC) in nerve cells.
As a polypeptide company, we will produce more high quality products for customers, if you have needs, please contact us.
More information about our pre clinical trial, please visit our website.
Click to Enlarge
SOURCE: Import-Export Bulletin Board (https://www.imexbb.com/)
Post an Offer to Sell
© 1996-2010 IMEXBB.com. All rights reserved.
|
|